Loading...
Statistics
现货沥é’å³åˆ»å¼€å¯ç¿»å€èµšé’±ä¹‹æ ...
www.yoh123.com/
Yoh123.com
Yoh123.com is hosted in
China
/
Shanghai
.
Yoh123.com doesn't use HTTPS protocol.
Number of used technologies:
3.
First technologies:
CSS, Html, Javascript,
Number of used javascripts: 4.
First javascripts:
Jquery-1.7.1.min.js, TabSwitch.js, Code.js,
Number of used analytics tools:
0.
Its server type is:
360wzws.
Technologies in use by Yoh123.com
Technology
Number of occurences: 3
- CSS
- Html
- Javascript
Advertisement
Javascripts
Number of occurences: 4
- jquery-1.7.1.min.js
- TabSwitch.js
- code.js
- utf8.js
Server Type
- 360wzws
Powered by
- ASP.NET
Conversion rate optimization |
|
|---|---|
Clickable call number
|
Not founded! |
|
Conversion form (contact form, subcriber)
|
Not founded! |
|
Clickable email
|
Not founded! |
|
CTA (call to action) button
|
Founded! |
|
List
|
Founded! |
|
Image
|
Not founded! |
|
Enhancement
|
Not founded! |
|
Responsive website
|
Not founded! |
|
Facebook sharing
|
Not founded! |
|
Google+ sharing
|
Not founded! |
|
Twitter sharing
|
Not founded! |
|
Linkedin sharing
|
Not founded! |
|
Blog on the webiste
|
Not founded! |
HTTPS (SSL) - Yoh123.com
Missing HTTPS protocol.
Number of occurences: 1
- Name:
Content: text/html; charset=utf-8
Server / Hosting
- IP: 222.73.144.205
- Latitude: 31.05
- Longitude: 121.40
- Country: China
- City: Shanghai
Rname
- ns1.360wzb.com
- ns2.360wzb.com
- 67f00f71f20dfb9b.360safedns.com
HTTP Header Response
HTTP/1.1 200 OK
Server: 360wzws
Date: Mon, 15 Aug 2016 05:02:59 GMT
Content-Type: text/html
X-Powered-By-360WZB: wangzhan.360.cn
Last-Modified: Mon, 13 Jun 2016 03:57:58 GMT
Accept-Ranges: bytes
ETag: "4d1cbdc527c5d11:0"
X-Powered-By: ASP.NET
X-Cache: MISS from s_hh40
X-Cache-Lookup: MISS from s_hh40:80
Transfer-Encoding: chunked
Via: 1.1 s_hh40 (squid/3.5.11)
Connection: keep-alive
DNS
host: yoh123.com
- class: IN
- ttl: 600
- type: A
- ip: 222.73.144.205
host: yoh123.com
- class: IN
- ttl: 600
- type: NS
- target: ns1.360wzb.com
host: yoh123.com
- class: IN
- ttl: 600
- type: NS
- target: ns2.360wzb.com
host: yoh123.com
- class: IN
- ttl: 600
- type: CNAME
- target: 67f00f71f20dfb9b.360safedns.com
Common Typos/Mistakes
This list shows You some spelling mistakes at internet search for this domain.
www.oh123.com, www.yzoh123.com, www.zoh123.com, www.yaoh123.com, www.aoh123.com, www.ysoh123.com, www.soh123.com, www.ydoh123.com, www.doh123.com, www.yoh123.com, www.oh123.com, www.ycoh123.com, www.coh123.com, www.y oh123.com, www. oh123.com, www.yh123.com, www.yobh123.com, www.ybh123.com, www.yohh123.com, www.yhh123.com, www.yogh123.com, www.ygh123.com, www.yojh123.com, www.yjh123.com, www.yomh123.com, www.ymh123.com, www.yo h123.com, www.y h123.com, www.yovh123.com, www.yvh123.com, www.yo123.com, www.yohe123.com, www.yoe123.com, www.yohd123.com, www.yod123.com, www.yohc123.com, www.yoc123.com, www.yohu123.com, www.you123.com, www.yohj123.com, www.yoj123.com, www.yoh123.com, www.yo123.com, www.yohb123.com, www.yob123.com, www.yohg123.com, www.yog123.com, www.yoh23.com, www.yoh1l23.com, www.yohl23.com, www.yoh1023.com, www.yoh023.com, www.yoh1923.com, www.yoh923.com, www.yoh13.com, www.yoh1203.com, www.yoh103.com, www.yoh12q3.com, www.yoh1q3.com, www.yoh12w3.com, www.yoh1w3.com, www.yoh12.com, www.yoh123q.com, www.yoh12q.com, www.yoh123w.com, www.yoh12w.com, www.yoh123e.com, www.yoh12e.com, www.yoh123.com, www.yoh12.com, www.yoh1231.com, www.yoh121.com,
Other websites we recently analyzed
- Singapore's Authentic Dragon's Beard Candies - Stage Elegance
Stage Elegance proudly presents: the 'Authentic Singapore Dragon's Beard Candies', a traditional chinese delicacy, made by Aunty Ho Lili! Suitable for Dinner and Dance, cultural events, trade fairs and food bazaars!Singapore (Singapore) - 203.175.162.72
Server software: Apache
Technology: CSS, Google Font API, Html, Javascript, Php
Number of Javascript: 3
Number of meta tags: 2 - sfs.navy
Scottsdale (United States) - 50.63.202.35
Server software: Microsoft-IIS/7.5
Technology: Html, Html5, Iframe - cvscaremarkspecialtypharmacy.net
Provo (United States) - 50.87.144.197
Server software: nginx/1.10.1
Technology: Html
Number of meta tags: 2 - App "bc5c3f2c7d" set up by ServerPilot
Rochester (United States) - 216.126.197.41
Server software: nginx
Technology: CSS, Google Font API, Html, Html5, Php
Number of meta tags: 1 - it-bgroup.ru
Russian Federation - 91.209.16.65
Server software: nginx/1.0.6
Technology: Html - The Family of Faith Lutheran Church | FOF
Absecon (United States) - 74.207.229.115
Server software: nginx
Technology: CSS, Flexslider, Gravatar, Html, Html5, Javascript, jQuery, Php, Pingback, Shortcodes, WordPress Stats, Wordpress
Number of Javascript: 17
Number of meta tags: 2 - mauicondotax.com
Wayne (United States) - 74.208.215.132
Server software: Apache
Technology: Html
Number of meta tags: 1 - Ponderings and Musings – Is there anyone out there who thinks like me? If not, is there anyone out there who likes to think?
Scottsdale (United States) - 166.62.110.213
Server software:
Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
Number of Javascript: 5
Number of meta tags: 3 - TBH Timmerwerken
TBH Timmerwerken heeft een moderne uitgebreide timmerwerkplaats in Moergestel, vlakbij Tilburg. TBH kan uw timmerwerk verzorgen in de meest ruime zin des woords zowel in de werkplaats als op de bouwplaats.Netherlands - 128.140.218.121
Server software: Apache/2
Technology: CSS, Flexslider, Font Awesome, Html, Html5, Iframe, Javascript, Google Analytics
Number of Javascript: 7
Number of meta tags: 4 - Mijndomein
Netherlands - 188.93.150.53
Server software: Apache/2.4.10
Technology: CSS, Html, Html5, SVG
Number of Javascript: 6
Number of meta tags: 5